SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356954 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356954
Domain Number 1 Region: 31-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000149
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000488
Family Fibronectin type I module 0.017
Further Details:      
 
Domain Number 3 Region: 198-242
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356954   Gene: ENSG00000118523   Transcript: ENST00000367976
Sequence length 349
Comment pep:known chromosome:GRCh37:6:132269316:132272513:-1 gene:ENSG00000118523 transcript:ENST00000367976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences P29279
ENSP00000356954 9606.ENSP00000356954 ENSP00000356954 ENSP00000356954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]