SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357266 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357266
Domain Number 1 Region: 51-500
Classification Level Classification E-value
Superfamily Sema domain 1.83e-148
Family Sema domain 0.0000000122
Further Details:      
 
Domain Number 2 Region: 496-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000453
Family Plexin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSP00000357266
Domain Number - Region: 559-638
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0531
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357266   Gene: ENSG00000196189   Transcript: ENST00000368283
Sequence length 761
Comment pep:known chromosome:GRCh37:1:156123376:156147535:1 gene:ENSG00000196189 transcript:ENST00000368283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKG
LQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPST
QVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLP
FNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGA
VFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMER
GNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREH
VKVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALIILVASPLRALRARGKVQGCE
TLRPGEKAPLSREQHLQSPKECRTSASDVDADNNCLGTEVA
Download sequence
Identical sequences Q9H3S1
ENSP00000347117 ENSP00000357265 ENSP00000357268 NYSGRC-IgSF-SEM4A_HUMAN ENSP00000347117 ENSP00000357265 ENSP00000357268 ENSP00000357266 NP_001180229.1.87134 NP_001180229.1.92137 NP_001180230.1.87134 NP_001180230.1.92137 NP_071762.2.87134 NP_071762.2.92137 XP_011508174.1.92137 XP_011508175.1.92137 XP_016857545.1.92137 9606.ENSP00000347117 gi|21361914|ref|NP_071762.2| gi|300863072|ref|NP_001180229.1| gi|300863074|ref|NP_001180230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]