SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357290 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357290
Domain Number 1 Region: 9-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-20
Family Ubiquitin-related 0.00013
Further Details:      
 
Domain Number 2 Region: 547-597
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000705
Family UBA domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000357290
Domain Number - Region: 217-266
Classification Level Classification E-value
Superfamily ARM repeat 0.00518
Family Mo25 protein 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357290   Gene: ENSG00000160803   Transcript: ENST00000368307
Sequence length 601
Comment pep:known chromosome:GRCh37:1:156005093:156023504:-1 gene:ENSG00000160803 transcript:ENST00000368307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPSGAETRPPIRVTVKTPKDKEEIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKI
LKDGDTLNQHGIKDGLTVHLVIKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQ
PSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFME
LQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLN
NPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMFSAAREQ
FGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHP
TVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFA
AQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQ
TEAPGLVPSLGSFGISRTPAPSAGSNAGSTPEAPTSSPATPATSSPTGASSAQQQLMQQM
IQLLAGSGNSQVQTPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQL
S
Download sequence
Identical sequences Q9NRR5
ENSP00000357292 9606.ENSP00000357292 ENSP00000357292 gi|40538799|ref|NP_064516.2| NP_064516.2.87134 NP_064516.2.92137 ENSP00000357290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]