SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357300 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357300
Domain Number 1 Region: 41-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.87e-16
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 2 Region: 146-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357300   Gene: ENSG00000146374   Transcript: ENST00000368317
Sequence length 292
Comment pep:known chromosome:GRCh37:6:127440183:127518910:1 gene:ENSG00000146374 transcript:ENST00000368317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL
HLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREII
QHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLES
SKEIPEQRENKQQQKKRKVQDKQKSGIEVTLAEGLTSVSQRTQPTPCRRRYL
Download sequence
Identical sequences G3RXU3
ENSP00000357300 ENSGGOP00000020630 ENSGGOP00000020630 ENSP00000357300 ENSP00000357300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]