SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357922 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000357922
Domain Number - Region: 205-253
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0602
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357922   Gene: ENSG00000143443   Transcript: ENST00000368926
Sequence length 341
Comment pep:known chromosome:GRCh37:1:151020216:151023896:1 gene:ENSG00000143443 transcript:ENST00000368926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAAGALLWVLLLNLGPRAAGAQGLTQTPTEMQRVSLRFGGPMTRSYRSTARTGLPRKT
RIILEDENDAMADADRLAGPAAAELLAATVSTGFSRSSAINEEDGSSEEGVVINAGKDST
SRELPSATPNTAGSSSTRFIANSQEPEIRLTSSLPRSPGRSTEDLPGSQATLSQWSTPGS
TPSRWPSPSPTAMPSPEDLRLVLMPWGPWHCHCKSGTMSRSRSGKLHGLSGRLRVGALSQ
LRTEHKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTTSTRTTTTPFPTIHLRSSPSL
PPASPCPALAFWKRVRIGLEDIWNSLSSVFTEMQPIDRNQR
Download sequence
Identical sequences Q9BUN1
ENSP00000357922 gi|20149646|ref|NP_060330.2| NP_060330.2.87134 NP_060330.2.92137 1029 ENSP00000357922 9606.ENSP00000357922 ENSP00000357922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]