SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359033 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359033
Domain Number 1 Region: 27-193,265-380
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.56e-53
Family FCH domain 0.013
Further Details:      
 
Domain Number 2 Region: 544-735
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.61e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 787-843
Classification Level Classification E-value
Superfamily SH3-domain 1.13e-17
Family SH3-domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359033   Gene: ENSG00000089820   Transcript: ENST00000370016
Sequence length 986
Comment pep:novel chromosome:GRCh37:X:153172908:153191698:-1 gene:ENSG00000089820 transcript:ENST00000370016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVE
LEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPSLLSPLHCWAVLLQHTRQQSRESAAL
SEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVN
AEAKLREAERQEEKRAGRSVPTTTAGATEAGPLRKSSLKKGGRLVEKLWPPQRPVAASSC
APVCWLQAGFLVHPPWWGAMCAPSTHQRQAKFMEHKLKCTKARNEYLLSLASVNAAVSNY
YLHDVLDLMDCCDTGFHLALGQVLRSYTAAESRTQASQVQGLGSLEEAVEALDPPGDKAK
VLEVHATVFCPPLRFDYHPHDGDEVAEICVEMELRDEILPRAQNIQSRLDRQTIETEEVN
KTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSDPGSRQAGRRRGQQQETETFY
LTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYTQRKFQKSRQPRPSSQY
NQRLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEGIFRVSGAQLRVSEIRDAFER
GEDPLVEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFGELLASSELEATAERVEHVSRL
LWRLPAPVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCFGPTLLPVPAGQDPVALQGRV
NQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEAEMPA
QEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYI
TLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPAS
PEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKG
FSRGPGAPASPSASHPQGLDTTPKPH
Download sequence
Identical sequences gi|258613907|ref|NP_001158213.1| NP_001158213.1.87134 NP_001158213.1.92137 ENSP00000359045 ENSP00000472759 ENSP00000359033 ENSP00000359045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]