SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359796 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359796
Domain Number 1 Region: 22-112
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.33e-36
Family SCAN domain 0.0000856
Further Details:      
 
Domain Number 2 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 319-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359796   Gene: ENSG00000173275   Transcript: ENST00000370760
Sequence length 518
Comment pep:known chromosome:GRCh37:X:134478721:134482708:1 gene:ENSG00000173275 transcript:ENST00000370760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALGCAIQASLNQGSVFQEYDTDCEVFRQRFRQFQYREAAGPHEAFNKLWELCCQWLK
PKMRSKEQILELLVLEQFLTILPTEIETWVREHCPENRERVVSLIEDLQRELEIPEQQVD
MHDMLLEELAPVGTAHIPPTMHLESPALQVMGPAQEAPVAEAWIPQAGPPELNYGATGEC
QNFLDPGYPLPKLDMNFSLENREEPWVKELQDSKEMKQLLDSKIGFEIGIENEEDTSKQK
KMETMYPFIVTLEGNALQGPILQKDYVQLENQWETPPEDLQTDLAKLVDQQNPTLGETPE
NSNLEEPLNPKPHKKKSPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEPHKCPECGKRF
LRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGS
SLKRHLKTHTGEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI
HLRIHTGEKPYKCTHCSKSFRQRAGLIMHQVTHFRGLI
Download sequence
Identical sequences Q6P9G9
NP_689908.3.87134 NP_689908.3.92137 XP_011529614.1.92137 ENSP00000359796 gi|194239638|ref|NP_689908.3| ENSP00000339585 9606.ENSP00000339585 ENSP00000339585 ENSP00000469080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]