SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361640 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361640
Domain Number 1 Region: 18-178,220-282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-69
Family BAR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 301-311,346-403
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000499
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361640   Gene: ENSG00000148341   Transcript: ENST00000372559
Sequence length 404
Comment pep:known chromosome:GRCh37:9:131770313:131790493:-1 gene:ENSG00000148341 transcript:ENST00000372559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQT
EVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAE
AEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATCEGDTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTR
LLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGSSQGAIFPGTFVGTTEP
ASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADS
SELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
Download sequence
Identical sequences A0A2I3MLD9 A0A2I3TAP6 A0A2J8UJP4 A0A2K5N0G0 A0A2K5UM56 A0A2K6BPX5 F7HSI0
ENSP00000361634 NP_001273974.1.87134 NP_001273974.1.92137 XP_005580731.1.63531 XP_008004183.1.81039 XP_009455735.1.37143 XP_011709882.1.29376 XP_011894292.1.92194 XP_014972096.1.72884 XP_016817301.1.37143 ENSP00000361634 ENSP00000361640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]