SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362007 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362007
Domain Number 1 Region: 382-505
Classification Level Classification E-value
Superfamily EF-hand 1.02e-47
Family EF-hand modules in multidomain proteins 0.0000092
Further Details:      
 
Domain Number 2 Region: 508-602
Classification Level Classification E-value
Superfamily EF-hand 1.45e-34
Family EF-hand modules in multidomain proteins 0.0000392
Further Details:      
 
Domain Number 3 Region: 584-670
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 220-341
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-16
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 5 Region: 344-381
Classification Level Classification E-value
Superfamily WW domain 0.0000000000116
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 79-176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000157
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362007   Gene: ENSG00000102385   Transcript: ENST00000372916
Sequence length 957
Comment pep:known chromosome:GRCh37:X:100474984:100506809:1 gene:ENSG00000102385 transcript:ENST00000372916 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQPMVMQGCPYTLPRCHDWQAADQFHHSSSLRSTCPHPQVRAAVTSPAPPQDGAGVPCLS
LKLLNGSVGASGPLEPPAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQ
KDEELSAQLPLQGDVALVQQEKETHAAFMEEVKSRGPYIYSVLESAQAFLSQHPFEELEE
PHSESKDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQGAM
EELSTTLSQAEGVRATWEPIGDLFIDSLPEHIQAIKLFKEEFSPMKDGVKLVNDLAHQLA
ISDVHLSMENSQALEQINVRWKQLQASVSERLKQLQDAHRDFGPGSQHFLSSSVQVPWER
AISPNKVPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDL
VTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLL
NVFDSGRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEAIQ
VPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVTI
AEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPT
TSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYSETPASSPMWPHADTHSR
IEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDREPAFGQQAPCSVATE
SKGELQKILAHLEDENRILQGELRRLKWQHEEAAEAPSLADGSTEAATDHRNEELLAEAR
ILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPTESDGSGSAGSSLASSPQQSEG
SHPREKGQTTPDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Download sequence
Identical sequences A0A024RCH3 Q13474
gi|148539558|ref|NP_001930.2| ENSP00000362007 ENSP00000378635 ENSP00000385038 ENSP00000441051 ENSP00000378635 ENSP00000385038 ENSP00000441051 9606.ENSP00000378635 NP_001930.2.87134 NP_001930.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]