SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362302 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362302
Domain Number 1 Region: 501-817
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.57e-88
Family PIWI domain 0.03
Further Details:      
 
Domain Number 2 Region: 36-387
Classification Level Classification E-value
Superfamily PAZ domain 2.2e-72
Family PAZ domain 0.000000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362302   Gene: ENSG00000092847   Transcript: ENST00000373206
Sequence length 857
Comment pep:known chromosome:GRCh37:1:36335409:36386559:1 gene:ENSG00000092847 transcript:ENST00000373206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIK
PDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGE
GKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFF
SPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRN
IDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQ
TVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTS
TMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGG
RNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAG
MPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGM
ATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPP
AGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPT
RIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNE
RIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQIL
TYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQAL
AKAVQVHQDTLRTMYFA
Download sequence
Identical sequences A0A096N7C0 A0A0D9S7T3 A0A1S3AD44 A0A1U7RCS0 A0A1U7UB89 A0A286XQ36 A0A287BNJ6 A0A287D6Q3 A0A2K5F5M6 A0A2K5JUG4 A0A2K5PE65 A0A2K5W6Z0 A0A2K5ZLA8 A0A2K6G1V4 A0A2K6L125 A0A2K6RP28 A0A2K6SKJ8 F1PGP5 F7GIF3 G1L139 G3QLB6 H2N806 H2PYM7 H9FSW2 K9IN18 M3VVB8 Q8CJG1 Q9UL18
ENSCAFP00000005209 ENSSTOP00000009740 ENSPVAP00000004811 ENSP00000362302 ENSCJAP00000003030 gi|6912352|ref|NP_036331.1| ENSMUSP00000095498 ENSAMEP00000000591 ENSCJAP00000003030 ENSAMEP00000000591 ENSPVAP00000004811 ENSPTRP00000000930 ENSCAFP00000005209 ENSPPYP00000001789 10090.ENSMUSP00000095498 9598.ENSPTRP00000000930 9600.ENSPPYP00000001789 9606.ENSP00000362300 ENSSSCP00000003935 ENSPANP00000008421 ENSSSCP00000003935 ENSSTOP00000009740 ENSPPYP00000001789 ENSP00000362300 PGODOG00000185950-0 ENSPTRP00000000930 ENSMUSP00000095498 NP_036331.1.87134 NP_036331.1.92137 NP_700452.2.92730 XP_002750657.1.60252 XP_002811104.1.23681 XP_002917173.1.58354 XP_003471425.1.53824 XP_003788226.1.62490 XP_003812627.1.60992 XP_003937563.1.74449 XP_004025499.1.27298 XP_004402728.1.74151 XP_004425999.1.5094 XP_004641074.1.9945 XP_004705027.1.18182 XP_004740859.1.14098 XP_004850999.1.39548 XP_005084439.1.91757 XP_005317863.1.77405 XP_005395218.1.28644 XP_005544046.1.63531 XP_005868643.1.60319 XP_006148746.1.99106 XP_006777367.1.95426 XP_006867592.1.41390 XP_006886503.1.29581 XP_006924308.1.64745 XP_006980140.1.50099 XP_007182574.1.59432 XP_007533150.1.11023 XP_007616785.1.28591 XP_007945841.1.48129 XP_007977619.1.81039 XP_008067375.1.4292 XP_008149345.1.99482 XP_010358713.1.97406 XP_011283036.1.62641 XP_011356270.1.92234 XP_011761715.1.29376 XP_011810723.1.43180 XP_011844377.1.47321 XP_012295206.1.9421 XP_012620690.1.48125 XP_014695599.1.49734 XP_014925787.1.86478 XP_016002737.1.101085 XP_016073810.1.3490 XP_017356574.1.71028 XP_017516487.1.32401 XP_017739968.1.44346 XP_019285672.1.44245 XP_019514224.1.44202 XP_019582068.1.88060 XP_020015242.1.5219 XP_021055946.1.100879 XP_021515598.1.76796 XP_021515599.1.76796 XP_513312.2.37143 XP_532563.3.84170 ENSP00000362300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]