SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362303 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362303
Domain Number 1 Region: 259-461
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.26e-49
Family Reprolysin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 554-609
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000575
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 974-1024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 912-971
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000011
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 5 Region: 850-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000122
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362303   Gene: ENSG00000138316   Transcript: ENST00000373207
Sequence length 1226
Comment pep:known chromosome:GRCh37:10:72432559:72522197:1 gene:ENSG00000138316 transcript:ENST00000373207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLRALLSYLLPLHCALCAAAGSRTPELHLSGKLSDYGVTVPCSTDFRGRFLSHVVSGP
AAASAGSMVVDTPPTLPRHSSHLRVARSPLHPGGTLWPGRVGRHSLYFNVTVFGKELHLR
LRPNRRLVVPGSSVEWQEDFRELFRQPLRQECVYTGGVTGMPGAAVAISNCDGLAGLIRT
DSTDFFIEPLERGQQEKEASGRTHVVYRREAVQQEWAEPDGDLHNEAFGLGDLPNLLGLV
GDQLGDTERKRRHAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESL
GVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLT
RQDFGPSGMQGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCAD
ETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYS
MDEQCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFK
GHCIWKSPEQTYGQDGGWSSWTKFGSCSRSCGGGVRSRSRSCNNPSPAYGGRLCLGPMFE
YQVCNSEECPGTYEDFRAQQCAKRNSYYVHQNAKHSWVPYEPDDDAQKCELICQSADTGD
VVFMNQVVHDGTRCSYRDPYSVCARGECVPVGCDKEVGSMKADDKCGVCGGDNSHCRTVK
GTLGKASKQAGALKLVQIPAGARHIQIEALEKSPHRIVVKNQVTGSFILNPKGKEATSRT
FTAMGLEWEDAVEDAKESLKTSGPLPEAIAILALPPTEGGPRSSLAYKYVIHEDLLPLIG
SNNVLLEEMDTYEWALKSWAPCSKACGGGIQFTKYGCRRRRDHHMVQRHLCDHKKRPKPI
RRRCNQHPCSQPVWVTEEWGACSRSCGKLGVQTRGIQCLLPLSNGTHKVMPAKACAGDRP
EARRPCLRVPCPAQWRLGAWSQCSATCGEGIQQRQVVCRTNANSLGHCEGDRPDTVQVCS
LPACGGNHQNSTVRADVWELGTPEGQWVPQSEPLHPINKISSTEPCTGDRSVFCQMEVLD
RYCSIPGYHRLCCVSCIKKASGPNPGPDPGPTSLPPFSTPGSPLPGPQDPADAAEPPGKP
TGSEDHQHGRATQLPGALDTSSPGTQHPFAPETPIPGASWSISPTTPGGLPWGWTQTPTP
VPEDKGQPGEDLRHPGTSLPAASPVT
Download sequence
Identical sequences ENSP00000362304 gi|110611167|ref|NP_631894.2| NP_631894.2.87134 NP_631894.2.92137 ENSP00000362303 ENSP00000362304 9606.ENSP00000362304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]