SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362777 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362777
Domain Number 1 Region: 39-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362777   Gene: ENSG00000179774   Transcript: ENST00000373673
Sequence length 152
Comment pep:known chromosome:GRCh37:10:69990386:69991871:-1 gene:ENSG00000179774 transcript:ENST00000373673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAF
DRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDH
YLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Download sequence
Identical sequences F1T0H4 G3RK03 H2Q1Z1 Q8N100
ENSP00000362777 ENSPTRP00000004403 ENSGGOP00000016058 gi|21553337|ref|NP_660161.1| ENSP00000362777 ENSPTRP00000004403 ENSP00000362777 ENSGGOP00000016058 9598.ENSPTRP00000004403 9606.ENSP00000362777 NP_660161.1.87134 NP_660161.1.92137 XP_004049541.1.27298 XP_521492.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]