SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000363494 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000363494
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-39
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 532-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.47e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 685-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 168-223
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-16
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSP00000363494
Domain Number - Region: 365-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000252
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363494   Gene: ENSG00000173258   Transcript: ENST00000374374
Sequence length 744
Comment pep:known chromosome:GRCh37:9:114287496:114290300:1 gene:ENSG00000173258 transcript:ENST00000374374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVVPLNKMTAISPEPQTLASTEQNEVPRVVTSGEQEAILRGNAADAESFRQRFRWFCY
SEVAGPRKALSQLWELCNQWLRPDIHTKEQILELLVFEQFLTILPGEIRIWVKSQHPESS
EEVVTLIEDLTQMLEEKDPVSQDSTVSQEENSKEDKMVTVCPNTESCESITLKDVAVNFS
RGEWKKLEPFQKELYKEVLLENLRNLEFLDFPVSKLELISQLKWVELPWLLEEVSKSSRL
DESALDKIIERCLRDDDHGLMEESQQYCGSSEEDHGNQGNSKGRVAQNKTLGSGSRGKKF
DPDKSPFGHNFKETSDLIKHLRVYLRKKSRRYNESKKPFSFHSDLVLNRKEKTAGEKSRK
SNDGGKVLSHSSALTEHQKRQKIHLGDRSQKCSKCGIIFIRRSTLSRRKTPMCEKCRKDS
CQEAALNKDEGNESGEKTHKCSKCGKAFGYSASLTKHRRIHTGEKPYMCNECGKAFSDSS
SLTPHHRTHSGEKPFKCDDCGKGFTLSAHLIKHQRIHTGEKPYKCKDCGRPFSDSSSLIQ
HQRIHTGEKPYTCSNCGKSFSHSSSLSKHQRIHTGEKPYKCGECGKAFRQNSCLTRHQRI
HTGEKPYLCNDCGMTFSHFTSVIYHQRLHSGEKPYKCNQCEKAFPTHSLLSRHQRIHTGV
KPYKCKECGKSFSQSSSLNEHHRIHTGEKPYECNYCGATFSRSSILVEHLKIHTGRREYE
CNECEKTFKSNSGLIRHRGFHSAE
Download sequence
Identical sequences Q8TF39
gi|190014620|ref|NP_597721.2| ENSP00000311679 9606.ENSP00000311679 NP_597721.2.87134 NP_597721.2.92137 XP_011516602.1.92137 XP_016869826.1.92137 XP_016869827.1.92137 ENSP00000363494 ENSP00000311679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]