SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000363725 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000363725
Domain Number 1 Region: 900-1091
Classification Level Classification E-value
Superfamily Bet v1-like 5.63e-51
Family STAR domain 0.000000698
Further Details:      
 
Domain Number 2 Region: 659-860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.61e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00052
Further Details:      
 
Domain Number 3 Region: 22-92
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-28
Family Variant SAM domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363725   Gene: ENSG00000130052   Transcript: ENST00000374597
Sequence length 1103
Comment pep:known chromosome:GRCh37:X:67913493:67945675:1 gene:ENSG00000130052 transcript:ENST00000374597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLDVFWSCFRKVKCFPLLQVKKNAEAEAKRACEWLQATGFPQYVQLFEEGSFPLDIGS
VKKNHGFLDEDSLGALCRRLMTLNNCASMKLEVHFQSKQNEDSEEEEQCTISSHWAFQQE
SKCWSPMGSSDLLAPPSPGLPATSSCESVLTELSATSLPVITVSLPPEPADLPLPGRAPS
SSDRPLLSPTQGQEGPQDKAKKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVS
KASSFRSCRGFLSAGFYRAKNWAATSAGGSGANTRKAWEAWPVASFRHPQWTHRGDCLVH
VPGDHKPGTFPRSLSIESLCPEDGHRLADWQPGRRWGCEGRRGSCGSTGSHASTYDNLPE
LYPAEPVMVGAEAEDEDDEESGGSYAHLDDILQHVWGLQQRVELWSRAMYPDLGPGDEEE
EEATSSVEIATVEVKCQAEALSQMEVPAHGESPAWAQAEVQPAVLAPAQAPAEAEPVAQE
EAEAPAPAPAPAPAQDSEQEAHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNE
AEAAGPLAGLQASMPRERRDSGVGASLTRPCRKLRWHSFQNSHRPSLNSESLEINRQFAG
QINLLHKGSLLRLTAFMEKYTVPHKQGWVWSMPKFMRRNKTPDYRGQHVFGVPPLIHVQR
TGQPLPQSIQQAMRYLRSQCLDQVGIFRKSGVKSRIQNLRQMNETSPDNVCYEGQSAYDV
ADLLKQYFRDLPEPIFTSKLTTTFLQIYQLLPKDQWLAAAQAATLLLPDENREVLQTLLY
FLSDIASAEENQMTAGNLAVCLAPSIFHLNVSKKDSPSPRIKSKRSLIGRPGPRDLSDNM
AATQGLSHMISDCKKLFQVPQDMVLQLCSSYSAAELSPPGPALAELRQAQAAGVSLSLYM
EENIQDLLRDAAERFKGWMSVPGPQHTELACRKAPDGHPLRLWKASTEVAAPPAVVLHRV
LRERALWDEDLLRAQVLEALMPGVELYHYVTDSMAPHPCRDFVVLRMWRSDLPRGGCLLV
SQSLDPEQPVPESGVRALMLTSQYLMEPCGLGRSRLTHICRADLRGRSPDWYNKVFGHLC
AMEVAKIRDSFPTLQAAGPETKL
Download sequence
Identical sequences ENSP00000363725 gi|215820650|ref|NP_001135975.1| 9606.ENSP00000363727 ENSP00000363727 NP_001135975.1.87134 NP_001135975.1.92137 ENSP00000363727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]