SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000364552 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364552
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.0000000051
Family TAP-C domain-like 0.023
Further Details:      
 
Weak hits

Sequence:  ENSP00000364552
Domain Number - Region: 53-178
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.00445
Family Tex N-terminal region-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364552   Gene: ENSG00000150401   Transcript: ENST00000375403
Sequence length 259
Comment pep:known chromosome:GRCh37:13:114110134:114145006:-1 gene:ENSG00000150401 transcript:ENST00000375403 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAV
DKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRK
EFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVA
YWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLI
DDFVEYARPVVTGGKRSLF
Download sequence
Identical sequences Q6PH85
GO.37169 gi|62122952|ref|NP_001014305.1| NP_001014305.1.87134 NP_001014305.1.92137 ENSP00000417706 ENSP00000364552 9606.ENSP00000417706 ENSP00000417706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]