SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365443 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365443
Domain Number 1 Region: 36-121
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.65e-28
Family SCAN domain 0.00021
Further Details:      
 
Domain Number 2 Region: 393-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 434-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 355-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365443   Gene: ENSG00000204532   Transcript: ENST00000376267
Sequence length 496
Comment pep:known chromosome:GRCh37:19:56717283:56720569:1 gene:ENSG00000204532 transcript:ENST00000376267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANCTSSWSLGESCNSPGSEPPQSMPSPATQLGNHDSDPETCHVNFRMFSCPKESDPIQ
ALRKLTELCHLWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVMMNGVQSCKDLEDLLR
NNRRPKKWSVVSFLGKEYLMQESDVEMAEAPASVRDDPRHVSSQRTSSVNQMCPEEGQAS
QELQTLPRVPALFRRQEEDFLLPETTVMKGDPKALRPKPTLEKDLEEDREENPGLTSPEP
QLPNSPTGVVGAKEGKEPQKRASVENVDADTPSACVVEREASTHSGSRGDALNLRGLKRS
KPDATSISQEEPQGEATPVGNRESPGQAEINPVHSPGPAGPVSHPSGQEVKELLPFACEV
CGKRFKYRGKLAVHTRSHTGERLFQCNLCGKRFMQRIGLQFHQRTHTGERPYTCDICQKQ
FTQKSYLKCHKRSHTGEKPFECKDCKKVFTYKANLKEHQRIHSGEKPHKCSKCPRAFGRP
ATLRRHQKTHREATSQ
Download sequence
Identical sequences A6NGD5
ENSP00000365443 ENSP00000435234 9606.ENSP00000365443 ENSP00000365443 ENSP00000365443 ENSP00000435234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]