SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366446 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000366446
Domain Number - Region: 326-372
Classification Level Classification E-value
Superfamily Plexin repeat 0.00082
Family Plexin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366446   Gene: ENSG00000120594   Transcript: ENST00000377238
Sequence length 529
Comment pep:known chromosome:GRCh37:10:20105168:20569286:1 gene:ENSG00000120594 transcript:ENST00000377238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGDQILDWQYGVTQAFPHTEEEVEVDSHA
YSHRWKRNLDFLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRI
YGPSDSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLREITVATG
GFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNL
GSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRT
IYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFD
RHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTS
LPTEDDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIIGILILVLIVATAILVTVYMYHH
PTSAASIFFIERRPSRWPAMKFRRGSGHPAYAEVEPVGEKEGFIVSEQC
Download sequence
Identical sequences Q6UX71
ENSP00000366460 9606.ENSP00000366460 ENSP00000366446 NP_116201.7.87134 NP_116201.7.92137 NYSGRC-40255005 gi|40255005|ref|NP_116201.7| ENSP00000366460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]