SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366527 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366527
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.14e-38
Family SCAN domain 0.0000555
Further Details:      
 
Domain Number 2 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-24
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 3 Region: 290-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366527   Gene: ENSG00000196812   Transcript: ENST00000340487
Sequence length 348
Comment pep:known chromosome:GRCh37:6:28092338:28097860:1 gene:ENSG00000196812 transcript:ENST00000340487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALT
QLWELCRQWLRPECHTKEQILDLLVLEQFLSILPKDLQAWVRAHHPETGEEAVTVLEDLE
RELDEPGKQVPGNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTR
TKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQRERRRYKCDE
CGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKD
FSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY
Download sequence
Identical sequences Q9H4T2
ENSP00000366527 ENSP00000366527 ENSP00000366527 NP_001307484.1.87134 NP_001307484.1.92137 NP_079507.1.87134 NP_079507.1.92137 XP_016866813.1.92137 9606.ENSP00000366527 gi|13376834|ref|NP_079507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]