SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366542 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366542
Domain Number 1 Region: 45-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.42e-38
Family SCAN domain 0.0000412
Further Details:      
 
Domain Number 2 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 426-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 342-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-18
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSP00000366542
Domain Number - Region: 287-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00016
Family Classic zinc finger, C2H2 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366542   Gene: ENSG00000197279   Transcript: ENST00000377325
Sequence length 485
Comment pep:known chromosome:GRCh37:6:28048753:28057341:1 gene:ENSG00000197279 transcript:ENST00000377325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQELCRQLFRQFCYQDS
PGPREALSRLRELCCQWLKPEIHTKEQILELLVLEQFLTILPGDLQAWVHEHYPESGEEA
VTILEDLERGTDEAVLQVQAHEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLL
WDCDNESENSRSMPKLEIFEKIESQRIISGRISGYISEASGESQDICKSAGRVKRQWEKE
SGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLNLNSNEFTHQKSCKHGTCDQS
FKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSGDKTHQCNECGKAFRHSSKLA
RHQRIHTGERCYECNECGKSFAESSDLTRHRRIHTGERPFGCKECGRAFNLNSHLIRHQR
IHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSECGRAFSQSSNLSQHQRIHMR
ENLLM
Download sequence
Identical sequences P49910 Q53Z40
ENSP00000366542 gi|4508001|ref|NP_003438.1| NP_003438.1.87134 NP_003438.1.92137 XP_016866747.1.92137 XP_016866748.1.92137 XP_016866749.1.92137 9606.ENSP00000252206 ENSP00000366542 ENSP00000366542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]