SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366988 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366988
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily PX domain 7.06e-17
Family PX domain 0.0047
Further Details:      
 
Domain Number 2 Region: 202-401
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000942
Family BAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366988   Gene: ENSG00000089006   Transcript: ENST00000377759
Sequence length 404
Comment pep:known chromosome:GRCh37:20:17922241:17949241:-1 gene:ENSG00000089006 transcript:ENST00000377759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS
PEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE
LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
Download sequence
Identical sequences H2P136 K7BDP9 Q9Y5X3
ENSP00000366988 ENSP00000366998 9598.ENSPTRP00000052352 9600.ENSPPYP00000011994 9606.ENSP00000366988 NP_055241.1.87134 NP_055241.1.92137 NP_689413.1.87134 NP_689413.1.92137 XP_002830028.1.23681 XP_008961178.1.60992 XP_008961179.1.60992 XP_009231606.1.23681 XP_009231607.1.23681 XP_016792968.1.37143 ENSPPYP00000011994 GO.79420 ENSP00000366988 ENSP00000366988 ENSP00000366998 gi|23111047|ref|NP_689413.1| gi|7657599|ref|NP_055241.1| ENSPPYP00000011994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]