SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000367094 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367094
Domain Number 1 Region: 51-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 2 Region: 115-185
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000167
Family VWC domain 0.05
Further Details:      
 
Domain Number 3 Region: 214-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000102
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367094   Gene: ENSG00000104415   Transcript: ENST00000377863
Sequence length 367
Comment pep:known chromosome:GRCh37:8:134203327:134239959:1 gene:ENSG00000104415 transcript:ENST00000377863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN
Download sequence
Identical sequences G3RGS7 O95388
ENSGGOP00000014832 ENSGGOP00000014832 NYSGXRC-13035a 9606.ENSP00000250160 gi|4507921|ref|NP_003873.1| ENSP00000250160 ENSP00000367094 NP_003873.1.87134 NP_003873.1.92137 XP_004047598.1.27298 ENSP00000250160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]