SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000367714 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367714
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000102
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSP00000367714
Domain Number - Region: 82-121
Classification Level Classification E-value
Superfamily Orange domain-like 0.000209
Family Hairy Orange domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367714   Gene: ENSG00000197921   Transcript: ENST00000378453
Sequence length 166
Comment pep:known chromosome:GRCh37:1:2460184:2461684:-1 gene:ENSG00000197921 transcript:ENST00000378453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
Download sequence
Identical sequences Q5TA89
ENSP00000367714 ENSP00000482150 NP_001010926.1.87134 NP_001010926.1.92137 ENSP00000367714 9606.ENSP00000367714 ENSP00000367714 gi|58219048|ref|NP_001010926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]