SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368801 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000368801
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily PDB 8.78e-28
Family PDB 0.008
Further Details:      
 
Domain Number 2 Region: 168-199
Classification Level Classification E-value
Superfamily WW domain 0.000000000412
Family WW domain 0.075
Further Details:      
 
Domain Number 3 Region: 127-158
Classification Level Classification E-value
Superfamily WW domain 0.00000000771
Family WW domain 0.0013
Further Details:      
 
Domain Number 4 Region: 9-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000308
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368801   Gene: ENSG00000120688   Transcript: ENST00000379487
Sequence length 376
Comment pep:known chromosome:GRCh37:13:41635410:41658137:1 gene:ENSG00000120688 transcript:ENST00000379487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRK
KDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTY
YYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGV
STETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEI
KQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRR
TENGKSRNLRQRGDDQ
Download sequence
Identical sequences O75554
ENSP00000368801 ENSP00000368801 ENSP00000368801 gi|6005948|ref|NP_009118.1| 9606.ENSP00000368801 5o9z_Q NP_009118.1.87134 NP_009118.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]