SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368831 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000368831
Domain Number 1 Region: 140-266
Classification Level Classification E-value
Superfamily PX domain 1.57e-31
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 303-514
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000174
Family BAR domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368831   Gene: ENSG00000205302   Transcript: ENST00000379516
Sequence length 519
Comment pep:known chromosome:GRCh37:5:122110691:122165803:1 gene:ENSG00000205302 transcript:ENST00000379516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAEDISANSNGPK
PTEVVLDDDREDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSA
PVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSV
KRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALE
RYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN
ESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAMLGNSEDHTAL
SRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA
QITLLKKREAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEK
ERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA
Download sequence
Identical sequences O60749
ENSP00000368831 gi|23111038|ref|NP_003091.2| 9606.ENSP00000368831 ENSP00000368831 ENSP00000368831 NP_003091.2.87134 NP_003091.2.92137 XP_004042459.1.27298 APC35309 HR4407 ENSGGOP00000002372 ENSGGOP00000002372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]