SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369944 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369944
Domain Number 1 Region: 1197-1272
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 1286-1378
Classification Level Classification E-value
Superfamily Immunoglobulin 6.99e-18
Family I set domains 0.0086
Further Details:      
 
Domain Number 3 Region: 1406-1488
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000368
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 888-951
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000344
Family I set domains 0.04
Further Details:      
 
Domain Number 5 Region: 669-728
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 6 Region: 1540-1607
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 783-849
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000981
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 8 Region: 432-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 32-81
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000693
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 376-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 11 Region: 529-583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 1669-1725
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 13 Region: 728-788
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 14 Region: 296-359
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 15 Region: 610-666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000484
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSP00000369944
Domain Number - Region: 1607-1666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000118
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number - Region: 1486-1545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000183
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369944   Gene: ENSG00000178031   Transcript: ENST00000380570
Sequence length 1762
Comment pep:putative chromosome:GRCh37:9:18474151:18622617:1 gene:ENSG00000178031 transcript:ENST00000380570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRC
LSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCS
LKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNG
DGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENS
LSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHR
WRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCP
ASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC
MYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKP
HIKEECIVPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV
GTQVRIVRCQVLLSFSQSVADLPIDECEGPKPASQRACYAGPCSGEIPEFNPDETDGLFG
GLQDFDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTREPAEENLCVTSRRPPQLLKS
CNLDPCPARWEIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILADELCRQPKPSTV
QACNRFNCPPAWYPAQWQPCSRTCGGGVQKREVLCKQRMADGSFLELPETFCSASKPACQ
QACKKDDCPSEWLLSDWTECSTSCGEGTQTRSAICRKMLKTGLSTVVNSTLCPPLPFSSS
IRPCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCP
ARRVRKPLITWEKDGQHLISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIKL
IGGNRKLVARPLSPRSEEEVLAGRKGGPKEALQTHKHQNGIFSNGSKAEKRGLAANPGSR
YDDLVSRLLEQGGWPGELLASWEAQDSAERNTTSEEDPGAEQVLLHLPFTMVTEQRRLDD
ILGNLSQQPEELRDLYSKHLVAQLAQEIFRSHLEHQDTLLKPSERRTSPVTLSPHKHVSG
FSSSLRTSSTGDAGGGSRRPHRKPTILRKISAAQQLSASEVVTHLGQTVALASGTLSVLL
HCEAIGHPRPTISWARNGEEVQFSDRILLQPDDSLQILAPVEADVGFYTCNATNALGYDS
VSIAVTLAGKPLVKTSRMTVINTEKPAVTVDIGSTIKTVQGVNVTINCQVAGVPEAEVTW
FRNKSKLGSPHHLHEGSLLLTNVSSSDQGLYSCRAANLHGELTESTQLLILDPPQVPTQL
EDIRALLAATGPNLPSVLTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTA
TGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCS
ASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRS
CGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVEWAFSSWGQCNG
PCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTA
TCGNYGFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCENMECRDTTRYCEKV
KQLKLCQLSQFKSRCCGTCGKA
Download sequence
Identical sequences Q8N6G6
gi|154275767|ref|NP_001035362.3| ENSP00000369944 9606.ENSP00000369921 ENSP00000369921 NP_001035362.3.87134 NP_001035362.3.92137 ENSP00000369921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]