SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371936 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371936
Domain Number 1 Region: 40-490
Classification Level Classification E-value
Superfamily Sema domain 1.15e-138
Family Sema domain 0.000000143
Further Details:      
 
Domain Number 2 Region: 837-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.06e-17
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 783-834
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000235
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 4 Region: 595-645
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000484
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 486-538
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000148
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 650-701
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000772
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 7 Region: 896-941
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000693
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 539-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000114
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371936   Gene: ENSG00000112902   Transcript: ENST00000382496
Sequence length 1074
Comment pep:known chromosome:GRCh37:5:9035138:9546187:-1 gene:ENSG00000112902 transcript:ENST00000382496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY
AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
DLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPNPNPHFQCGTV
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII
YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVV
KIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVD
GHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
PWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS
EWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
Download sequence
Identical sequences Q13591 X5DR95
ENSP00000371936 9606.ENSP00000371936 gi|147904700|ref|NP_003957.2| ENSP00000371936 ENSP00000371936 NP_003957.2.87134 NP_003957.2.92137 XP_006714569.1.92137 XP_006714570.1.92137 XP_011512457.1.92137 XP_011512458.1.92137 XP_011512459.1.92137 XP_011512460.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]