SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377380 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377380
Domain Number 1 Region: 607-820
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.000059
Further Details:      
 
Domain Number 2 Region: 394-518
Classification Level Classification E-value
Superfamily PH domain-like 1.74e-19
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 90-169
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000123
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 4 Region: 289-318
Classification Level Classification E-value
Superfamily WW domain 0.0000124
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377380   Gene: ENSG00000123329   Transcript: ENST00000393791
Sequence length 821
Comment pep:known chromosome:GRCh37:12:57866038:57873633:-1 gene:ENSG00000123329 transcript:ENST00000393791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGSSDSCASGSQVAGTTVAGPAHPESLTLCSGEAERRGKEEWPDSHHYPGPTPAPESS
DGPHKVTVLATMLSSRWWPSSWGILGLGPRSPPRGSQLCALYAFTYTGADGQQVSLAEGD
RFLLLRKTNSDWWLARRLEAPSTSRPIFVPAAYMIEESIPSQSPTTVIPGQLLWTPGPKL
FHGSLEELSQALPSRAQASSEQPPPLPRKMCRSVSTDNLSPSLLKPFQEGPSGRSLSQED
LPSEASASTAGPQPLMSEPPVYCNLVDLRRCPRSPPPGPACPLLQRLDAWEQHLDPNSGR
CFYINSLTGCKSWKPPRRSRSETNPGSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDP
QGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSW
VVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIP
GHEFLLQSDHETELRAWHRALRTVIERLVRWVEARREAPTGRDQGSGDRENPLELRLSGS
GPAELSAGEDEEEESELVSKPLLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPLQSL
QERGLLRDQVFGCQLESLCQREGDTVPSFLRLCIAAVDKRGLDVDGIYRVSGNLAVVQKL
RFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTEWDDIHVVTGALKLFLRELPQPLVPPL
LLPHFRAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLCRVIAHSDKNRMTPHNL
GIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTNFTSLFP
Download sequence
Identical sequences J3KPQ4
ENSP00000377386 ENSP00000377386 NP_001306779.1.87134 NP_001306779.1.92137 ENSP00000377380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]