SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000378292 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378292
Domain Number 1 Region: 315-389
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.26e-20
Family Intermediate filament protein, coiled coil region 0.00045
Further Details:      
 
Domain Number 2 Region: 81-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000162
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSP00000378292
Domain Number - Region: 119-193
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000785
Family Intermediate filament protein, coiled coil region 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378292   Gene: ENSG00000167767   Transcript: ENST00000394815
Sequence length 452
Comment pep:known chromosome:GRCh37:12:52562780:52585784:-1 gene:ENSG00000167767 transcript:ENST00000394815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTV
NPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQG
QDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTD
MEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGM
DSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIA
DLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMA
RQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSK
APSRKKKGSKGPVIKITEMSEKYFSQESEVSE
Download sequence
Identical sequences Q6KB66
ENSP00000378292 9606.ENSP00000378292 ENSP00000378292 gi|125628636|ref|NP_872313.2| ENSP00000378292 NP_872313.2.87134 NP_872313.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]