SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000378911 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378911
Domain Number 1 Region: 256-466
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.14e-55
Family Reprolysin-like 0.00051
Further Details:      
 
Domain Number 2 Region: 554-610
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000314
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 1204-1263
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000798
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 1354-1415
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 1074-1134
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 961-1022
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 7 Region: 1018-1077
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000445
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 8 Region: 1154-1206
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000549
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 9 Region: 1303-1359
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 10 Region: 1655-1709
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000968
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 11 Region: 1420-1474
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 12 Region: 1469-1530
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000602
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 13 Region: 849-902
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000051
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSP00000378911
Domain Number - Region: 911-962
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0157
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 1590-1637
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0772
Family TSP-1 type 1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378911   Gene: ENSG00000173157   Transcript: ENST00000395541
Sequence length 1910
Comment pep:known chromosome:GRCh37:12:43816622:43833515:-1 gene:ENSG00000173157 transcript:ENST00000395541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVAKWLTGLLYHLSLFITRSWEVDFHPRQEALVRTLTSYEVVIPERVNEFGEVFPQSHH
FSRQKRSSEALEPMPFRTHYRFTAYGQLFQLNLTADASFLAAGYTEVHLGTPERGAWESD
AGPSDLRHCFYRGQVNSQEDYKAVVSLCGGLTGTFKGQNGEYFLEPIMKADGNEYEDGHN
KPHLIYRQDLNNSFLQTLKYCSVSESQIKETSLPFHTYSNMNEDLNVMKERVLGHTSKNV
PLKDERRHSRKKRLISYPRYIEIMVTADAKVVSAHGSNLQNYILTLMSIVATIYKDPSIG
NLIHIVVVKLVMIHREEEGPVINFDGATTLKNFCSWQQTQNDLDDVHPSHHDTAVLITRE
DICSSKEKCNMLGLSYLGTICDPLQSCFINEEKGLISAFTIAHELGHTLGVQHDDNPRCK
EMKVTKYHVMAPALSFHMSPWSWSNCSRKYVTEFLDTGYGECLLDKPDEEIYNLPSELPG
SRYDGNKQCELAFGPGSQMCPHINICMHLWCTSTEKLHKGCFTQHVPPADGTDCGPGMHC
RHGLCVNKETETRPVNGEWGPWEPYSSCSRTCGGGIESATRRCNRPEPRNGGNYCVGRRM
KFRSCNTDSCPKGTQDFREKQCSDFNGKHLDISGIPSNVRWLPRYSGIGTKDRCKLYCQV
AGTNYFYLLKDMVEDGTPCGTETHDICVQGQCMAAGCDHVLNSSAKIDKCGVCGGDNSSC
KTITGVFNSSHYGYNVVVKIPAGATNVDIRQYSYSGQPDDSYLALSDAEGNFLFNGNFLL
STSKKEINVQGTRTVIEYSGSNNAVERINSTNRQEKELILQVLCVGNLYNPDVHYSFNIP
LEERSDMFTWDPYGPWEGCTKMCQGLQRRNITCIHKSDHSVVSDKECDHLPLPSFVTQSC
NTDCELRWHVIGKSECSSQCGQGYRTLDIHCMKYSIHEGQTVQVDDHYCGDQLKPPTQEL
CHGNCVFTRWHYSEWSQCSRSCGGGERSRESYCMNNFGHRLADNECQELSRVTRENCNEF
SCPSWAASEWSECLVTCGKGTKQRQVWCQLNVDHLSDGFCNSSTKPESLSPCELHTCASW
QVGPWGPCTTTCGHGYQMRDVKCVNELASAVLEDTECHEASRPSDRQSCVLTPCSFISKL
ETALLPTVLIKKMAQWRHGSWTPCSVSCGRGTQARYVSCRDALDRIADESYCAHLPRPAE
IWDCFTPCGEWQAGDWSPCSASCGHGKTTRQVLCMNYHQPIDENYCDPEVRPLMEQECSL
AACPPAHSHFPSSPVQPSYYLSTNLPLTQKLEDNENQVVHPSVRGNQWRTGPWGSCSSSC
SGGLQHRAVVCQDENGQSASYCDAASKPPELQQCGPGPCPQWNYGNWGECSQTCGGGIKS
RLVICQFPNGQILEDHNCEIVNKPPSVIQCHMHACPADVSWHQEPWTSCSASCGKGRKYR
EVFCIDQFQRKLEDTNCSQVQKPPTHKACRSVRCPSWKANSWNECSVTCGSGVQQRDVYC
RLKGVGQVVEEMCDQSTRPCSQRRCWSQDCVQHKGMERGRLNCSTSCERKDSHQRMECTD
NQIRQVNEIVYNSSTISLTSKNCRNPPCNYIVVTADSSQCANNCGFSYRQRITYCTEIPS
TKKHKLHRLRPIVYQECPVVPSSQVYQCINSCLHLATWKVGKWSKCSVTCGIGIMKRQVK
CITKHGLSSDLCLNHLKPGAQKKCYANDCKSFTTCKEIQVKNHIRKDGDYYLNIKGRIIK
IYCADMYLENPKEYLTLVQGEENFSEVYGFRLKNPYQCPFNGSRREDCECDNGHLAAGYT
VFSKIRIDLTSMQIKTTDLLFSKTIFGNAVPFATAGDCYSAFRCPQGQFSINLSGTGMKI
SSTAKWLTQGSYTSVSIRRSEDGTRFFGKCGGYCGKCLPHMTTGLPIQVI
Download sequence
Identical sequences NP_079279.3.87134 NP_079279.3.92137 ENSP00000374071 gi|124430557|ref|NP_079279.3| ENSP00000374071 ENSP00000378911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]