SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000379855 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379855
Domain Number 1 Region: 117-295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000187
Further Details:      
 
Domain Number 2 Region: 623-729
Classification Level Classification E-value
Superfamily SH2 domain 7.27e-31
Family SH2 domain 0.000000653
Further Details:      
 
Domain Number 3 Region: 323-430
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-30
Family SH2 domain 0.00000067
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-17
Family SH3-domain 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379855   Gene: ENSG00000145675   Transcript: ENST00000396611
Sequence length 732
Comment pep:known chromosome:GRCh37:5:67522462:67597647:1 gene:ENSG00000145675 transcript:ENST00000396611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH
VLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEENFLSCLPSQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESS
KQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNV
TLAYPVYAQQRR
Download sequence
Identical sequences ENSP00000379855 ENSP00000379855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]