SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380024 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380024
Domain Number 1 Region: 166-248
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-26
Family PHD domain 0.00000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380024   Gene: ENSG00000111653   Transcript: ENST00000396807
Sequence length 249
Comment pep:known chromosome:GRCh37:12:6759757:6772306:-1 gene:ENSG00000111653 transcript:ENST00000396807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEE
KLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSD
YDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGS
VHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP
RCSQERKKK
Download sequence
Identical sequences A0A096NS16 A0A0D9RDD4 A0A1D5QYV2 A0A2J8TBA3 A0A2K5LLI0 A0A2K5Y0G3 A0A2K6D3F7 A0A2K6KH36 F7HUX9 G8F3S4 Q9UNL4
ENSNLEP00000005441 ENSP00000380024 ENSNLEP00000005441 NP_001121054.1.87134 NP_001121054.1.92137 XP_002807127.2.60252 XP_003273784.1.23891 XP_003942202.1.74449 XP_004052622.1.27298 XP_005569986.1.63531 XP_007965566.1.81039 XP_010384230.1.97406 XP_011743892.1.29376 XP_011838356.1.47321 XP_011909722.1.92194 XP_012328234.1.9421 XP_015006399.1.72884 XP_017401594.1.71028 XP_017747334.1.44346 ENSGGOP00000015639 ENSMMUP00000022340 ENSMMUP00000022340 gi|189083821|ref|NP_001121054.1| ENSP00000380024 ENSCJAP00000014925 HR5294 9544.ENSMMUP00000022340 9606.ENSP00000380024 ENSGGOP00000015639 ENSP00000380024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]