SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000381760 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000381760
Domain Number - Region: 16-80
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0122
Family Motor proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381760   Gene: ENSG00000214686   Transcript: ENST00000398780
Sequence length 107
Comment pep:known chromosome:GRCh37:3:51812580:51813009:-1 gene:ENSG00000214686 transcript:ENST00000398780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRRTLLQAALRAWVIQCWWRSMQAKMLEQRRRLALRLYTCQEWAVVKVQAQVRMWQARR
RFLQARQAACIIQSHWRWHASQTRGLIRGHYEVRASRLELDIEILMT
Download sequence
Identical sequences A8MYZ5
gi|254028213|ref|NP_001137305.2| NP_001137305.2.87134 NP_001137305.2.92137 XP_011532030.1.92137 ENSP00000381760 ENSP00000381760 ENSP00000381760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]