SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000382086 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000382086
Domain Number 1 Region: 190-286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000336
Family Spectrin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382086   Gene: ENSG00000214860   Transcript: ENST00000399134
Sequence length 301
Comment pep:novel chromosome:GRCh37:17:18280976:18292961:1 gene:ENSG00000214860 transcript:ENST00000399134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQASADQVERDILETQKRLQQDRLNSEQSQALQHQQETGSSLKEAEVLLKDLFLDVDKAR
RLKHPQAEETEKDIEQLHERVTQECAEYCALYEKMVLPPRRGIQGRLGTRAGAETEAGLR
RPVWAGHGGAGGTDRGAQHRAEGDQRPRRAAAEPGGAGCRHHPEPIPRPTEGGVVARAEP
GQPVHALQGCTWQLSALAEQQRRILQQDWSDLMADPAGVRREYEHFKQHELLSQEQSVNQ
LEEDGKRMVELRHPAVGPIQAHQEALKMEWQNFLNLCICQETQLQHVEDYSRILCPSSSP
H
Download sequence
Identical sequences A8MZ36
ENSP00000382086 ENSP00000382086 NP_001138599.1.87134 NP_001138599.1.92137 9606.ENSP00000382086 gi|223468634|ref|NP_001138599.1| ENSP00000382086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]