SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000383517 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383517
Domain Number 1 Region: 285-343
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 55-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 176-230
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000706
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 4 Region: 230-290
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000111
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 3-58
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 6 Region: 123-173
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383517   Gene: ENSG00000215616   Transcript: ENST00000400678
Sequence length 387
Comment pep:known supercontig:GRCh37:GL000201.1:3905:22432:1 gene:ENSG00000215616 transcript:ENST00000400678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRWKLSSHEPCSATCTTGVMSAYAMCVRYDGVEVDDSYCDALTRPEPVHEFCAGRECQP
RWETSSWSECSRTCGEGYQFRVVRCWKMLSPGFDSSVYSDLCEAAEAVRPEERKTCRNPA
CGPQWEMSEWSECTAKCGERSVVTRDIRCSEDEKLCDPNTRPVGEKNCTGPPCDRQWTVS
DWGPCSGSCGQGRTIRHVYCKTSDGRVVPESQCQMETKPLAIHPCGDKNCPAHWLAQDWE
RCNTTCGRGVKKRLVLCMELANGKPQTRSGPECGLAKKPPEESTCFERPCFKWYTSPWSE
CTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCPTEPPDDSCQDQPGTNC
ALAIKVNLCGHWYYSKACCRSCRPPHS
Download sequence
Identical sequences ENSP00000383517 ENSP00000383517 9606.ENSP00000383517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]