SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000384571 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384571
Domain Number 1 Region: 8-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.49e-36
Family Cap-Gly domain 0.00083
Further Details:      
 
Domain Number 2 Region: 107-400
Classification Level Classification E-value
Superfamily RNI-like 1.73e-28
Family Cyclin A/CDK2-associated p19, Skp2 0.046
Further Details:      
 
Domain Number 3 Region: 491-578
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.54e-21
Family Ubiquitin-related 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384571   Gene: ENSG00000116957   Transcript: ENST00000406207
Sequence length 578
Comment pep:known chromosome:GRCh37:1:235530728:235612278:1 gene:ENSG00000116957 transcript:ENST00000406207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTLTADVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFK
CRHPTGGSFIRPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIM
KQQSQLSKLQEVSLRNCAVSCAGEKGGVAEACPNIRKVDLSKNLLSSWDEVIHIADQLRH
LEVLNVSENKLKFPSGSVLTGTLSVLKVLVLNQTGITWAEAHAQCGGSRHGLDMQKDASK
FVDLCVLQKCSTSNCIISAKDHTSMRMNVAKVLRCVAGCPGLEELYLESNNIFISERPTD
VLQTVKLLDLSSNQLIDENQLYLIAHLPRLEQLILSDTGISSLHFPDAGIGCKTSMFPSL
KYLVVNDNQISQWSFFNELEKLPSLRALSCLRNPLTKEDKEAETARLLIIASIGQLKTLN
KCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPRYQFLCLKYGAPE
DWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDL
LLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Download sequence
Identical sequences NP_001274730.1.87134 NP_001274730.1.92137 ENSP00000439170 ENSP00000384571 ENSP00000439170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]