SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385591 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000385591
Domain Number - Region: 368-466
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00649
Family Arfaptin, Rac-binding fragment 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385591   Gene: ENSG00000166960   Transcript: ENST00000403303
Sequence length 891
Comment pep:known chromosome:GRCh37:18:30517367:31020045:-1 gene:ENSG00000166960 transcript:ENST00000403303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENKTVSSSSTRDDQTNIGLTCQEVKALREKAWSRTNEGNAMSQSLVLYGASKENSEGF
HESKMTNTEGVNKGIYFSYPCRRHSCAVVNIPAPCVNKMISHIQDVESKIQEHLKRFETS
FEEWSRTSSTKDLKEDWSVTTPVKEVKPGEKRDEKCPELKQEMETLLSEAIRLIKSLETD
RADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKAN
QLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQELQDLKNHYKKKMEVMDLHRK
VNEELEEALEACENARLKAQQIKEEIDKDIYQDEKTIEAYKREIYQLNSLFDHYSSSVIN
VNTNIEEKEEEVTEAIRETKSSKNELHSLSKMLEDLRRVYDQLTWKQKSHENQYLEAVND
FYAAKKTWDIELSDVAKDFSAISLACTKLTEDNKKLEIDINKITVKTNESIRKKSKYESE
IKYLTIMKLKNDKHLKNIYKEAYRIGTLFHLTKHKTDEMEDKIAEVRRKFKGREEFLKKL
TQGEVAAGMVLQKKLYSIYEVQALERKELIKNRAICAMSLAELQEPLLQLEDEAERIRSL
DKEHSVMLNNIIDQKDLIRRKVGKVKKKLRKKGKKTLDALIETESKRSAIFKDLEATKSK
TMIFYAKINELNEELKAKEEEKKSFDQTLEILKNKFITMRFKREHAQTVFDHYMQEKKDC
EERIFEEDQRFRVLLAVRQKTLQDTQKIIADSLEENLRLAQEYQQLQITFLKEKDNYFNI
YDKQLSLDTSIRDKKQVAGFLPKKLPNSLPIISDELSNFQLCQLQRRMHTLWQEHFKLVV
LFSQMRLANFQTDSQESIQKILAVQEESSNLMQHILGFFQTLTDGTCENDG
Download sequence
Identical sequences F8W7A7
ENSP00000385867 ENSP00000463254 NP_001295055.1.87134 NP_001295055.1.92137 XP_016881210.1.92137 XP_016881211.1.92137 XP_016881212.1.92137 ENSP00000385591 ENSP00000385867 ENSP00000463254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]