SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386241 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386241
Domain Number 1 Region: 157-354
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.53e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 37-150
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-32
Family Pleckstrin-homology domain (PH domain) 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386241   Gene: ENSG00000163219   Transcript: ENST00000409220
Sequence length 646
Comment pep:novel chromosome:GRCh37:2:69001933:69053965:1 gene:ENSG00000163219 transcript:ENST00000409220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKLPRNWDFNLKVEAAKIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIV
KNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWD
QNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPIL
VEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYL
RDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQ
LNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDI
PLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMTSDSDTTSPTGQQPSDAFPE
DSSKVPREKPGDWKMQSRKRTQTLPNRKCFLTSAFQGANSSKMEIFKNEFWSPSSEAKAG
EGHRRTMSQDLRQLSDSQRTSTYDNVPSLPGSPGEEASALSSQACDSKGDTLASPNSETG
PGKKNSGEEEIDSLQRMVQELRKEIETQKQMYEEQIKNLEKENYDVWAKVVRLNEELEKE
KKKSAALEISLRNMERSREDVEKRNKALEEEVKEFVKSMKEPKTEA
Download sequence
Identical sequences NP_001007232.2.87134 NP_001007232.2.92137 ENSP00000386911 ENSP00000386241 gi|261399907|ref|NP_001007232.2| ENSP00000386911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]