SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386523 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386523
Domain Number 1 Region: 58-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386523   Gene: ENSG00000059728   Transcript: ENST00000409442
Sequence length 221
Comment pep:known chromosome:GRCh37:2:70142241:70165324:1 gene:ENSG00000059728 transcript:ENST00000409442 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQID
QLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSS
SSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL
Download sequence
Identical sequences G3R6P1 H2QI19 Q05195
ENSP00000386523 9598.ENSPTRP00000020645 9606.ENSP00000264444 ENSP00000264444 ENSP00000264444 NP_002348.1.87134 NP_002348.1.92137 XP_003830981.1.60992 XP_004029410.2.27298 XP_525776.2.37143 ENSPTRP00000020645 gi|4505069|ref|NP_002348.1| ENSPTRP00000020645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]