SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000388768 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388768
Domain Number 1 Region: 26-500
Classification Level Classification E-value
Superfamily Sema domain 3.66e-171
Family Sema domain 0.0000000000000105
Further Details:      
 
Domain Number 2 Region: 502-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000114
Family Plexin repeat 0.0000388
Further Details:      
 
Domain Number 3 Region: 563-650
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000452
Family I set domains 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388768   Gene: ENSG00000187764   Transcript: ENST00000422704
Sequence length 862
Comment pep:known chromosome:GRCh37:9:91992306:92113004:-1 gene:ENSG00000187764 transcript:ENST00000422704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSV
VQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQL
HSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
Download sequence
Identical sequences Q92854
9606.ENSP00000343418 NP_006369.3.87134 NP_006369.3.92137 XP_005251711.1.92137 XP_011516425.1.92137 XP_011516426.1.92137 XP_011516427.1.92137 XP_011516429.1.92137 XP_011516430.1.92137 XP_011516431.1.92137 XP_011516432.1.92137 XP_011516433.1.92137 XP_011516435.1.92137 XP_011516436.1.92137 XP_016869682.1.92137 XP_016869683.1.92137 XP_016869684.1.92137 XP_016869685.1.92137 XP_016869686.1.92137 XP_016869687.1.92137 ENSP00000388768 ENSP00000348822 ENSP00000388768 ENSP00000405102 ENSP00000416523 NYSGRC-IgSF-SEM4D_HUMAN OPTIC7164 ENSP00000348822 ENSP00000388768 ENSP00000405102 ENSP00000416523 gi|214010218|ref|NP_006369.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]