SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389787 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389787
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-28
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 2 Region: 148-218
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.56e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389787   Gene: ENSG00000166289   Transcript: ENST00000436066
Sequence length 279
Comment pep:known chromosome:GRCh37:19:30155963:30166364:1 gene:ENSG00000166289 transcript:ENST00000436066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFND
ILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQ
EWISHIEECVRRQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGF
VVCAECSRQRFLLPRLSPKPVRVCSLCYRELAAQQRQEEAEEQGAGSPGQPAHLARPICG
ASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS
Download sequence
Identical sequences Q96S99
gi|153791377|ref|NP_077286.3| ENSP00000389787 NP_077286.3.87134 NP_077286.3.92137 XP_011525611.1.92137 9606.ENSP00000299373 ENSP00000389787 ENSP00000466292 ENSP00000389787 ENSP00000466292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]