SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390721 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390721
Domain Number 1 Region: 457-525
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000068
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 
Weak hits

Sequence:  ENSP00000390721
Domain Number - Region: 77-107
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00162
Family Intermediate filament protein, coiled coil region 0.0049
Further Details:      
 
Domain Number - Region: 224-301
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0131
Family Sec2 N-terminal region 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390721   Gene: ENSG00000010295   Transcript: ENST00000436152
Sequence length 563
Comment pep:known chromosome:GRCh37:12:6647541:6661066:-1 gene:ENSG00000010295 transcript:ENST00000436152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPLFGPNLFLLQQEQQGLAGPLGDSLGGDHFAGGGDLPPAPLSPAGPAAYSPPGPGPAP
PAAMALRNDLGSNINVLKTLNLRFRCFLAKVHELERRNRLLEKQLQQALEEGKQGRRGLG
RRDQAVQTGFVSPIRPLGLQLGARPAAVCSPSARVLGSPARSPAGPLAPSAASLSSSSTS
TSTTYSSSARFMPGTIWSFSHARRLGPGLEPTLVQGPGLSWVHPDGVGVQIDTITPEIRA
LYNVLAKVKRERDEYKRRWEEEYTVRIQLQDRVNELQEEAQEADACQEELALKVEQLKAE
LVVFKGLMSNNLSELDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNCEDMIQMFQKKL
VPSMGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFED
DCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQET
IDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLS
DPPPPPSEAEDSDRDVSSDSSMR
Download sequence
Identical sequences ENSP00000390721 NP_001034759.1.87134 NP_001034759.1.92137 XP_003820355.1.60992 9606.ENSP00000349364 gi|89213250|ref|NP_001034759.1| ENSP00000349364 ENSP00000349364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]