SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391561 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391561
Domain Number 1 Region: 24-120
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-21
Family V set domains (antibody variable domain-like) 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391561   Gene: ENSG00000211695   Transcript: ENST00000444775
Sequence length 122
Comment pep:known chromosome:GRCh37:7:38356618:38358462:-1 gene:ENSG00000211695 transcript:ENST00000444775 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene
Sequence
MLSLLHTSTLAVLGALCVYGAGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRE
RPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALW
EV
Download sequence
Identical sequences Q99603
9606.ENSP00000391561 ENSP00000391561 ENSP00000391561 ENSP00000391561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]