SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393218 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393218
Domain Number 1 Region: 54-215
Classification Level Classification E-value
Superfamily EF-hand 5.83e-42
Family Penta-EF-hand proteins 0.0000000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393218   Gene: ENSG00000115271   Transcript: ENST00000446271
Sequence length 217
Comment pep:putative chromosome:GRCh37:2:163175394:163213323:1 gene:ENSG00000115271 transcript:ENST00000446271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSA
VAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAA
LNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVA
CCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
Download sequence
Identical sequences P28676
gi|6912388|ref|NP_036330.1| 9606.ENSP00000394842 ENSP00000394842 NP_036330.1.87134 NP_036330.1.92137 ENSP00000394842 ENSP00000393218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]