SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000393307 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393307
Domain Number 1 Region: 1255-1449
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.9e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000367
Further Details:      
 
Domain Number 2 Region: 28-64,128-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.95e-19
Family G proteins 0.0091
Further Details:      
 
Domain Number 3 Region: 427-488
Classification Level Classification E-value
Superfamily FF domain 0.000000275
Family FF domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSP00000393307
Domain Number - Region: 279-329
Classification Level Classification E-value
Superfamily FF domain 0.0279
Family FF domain 0.0068
Further Details:      
 
Domain Number - Region: 483-548
Classification Level Classification E-value
Superfamily FF domain 0.0366
Family FF domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393307   Gene: ENSG00000100852   Transcript: ENST00000432921
Sequence length 1502
Comment pep:known chromosome:GRCh37:14:32546495:32628934:1 gene:ENSG00000100852 transcript:ENST00000432921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKNKEPRPPSYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAYKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPIPANKDLSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
IHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDR
TSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINL
VSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPV
NYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVET
FIQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLG
II
Download sequence
Identical sequences H2R9D6 Q13017
9598.ENSPTRP00000052727 9606.ENSP00000371897 ENSP00000371897 ENSP00000441692 gi|71834863|ref|NP_001025226.1| ENSP00000371897 ENSP00000441692 ENSPTRP00000052727 ENSP00000393307 NP_001025226.1.87134 NP_001025226.1.92137 XP_003821249.1.60992 XP_003954481.1.37143 XP_005267692.1.92137 XP_005267693.1.92137 XP_014203032.1.60992 XP_016781460.1.37143 XP_016781461.1.37143 XP_016876776.1.92137 ENSPTRP00000052727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]