SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393431 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393431
Domain Number 1 Region: 27-110
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.06e-30
Family MHC antigen-recognition domain 0.0000156
Further Details:      
 
Domain Number 2 Region: 113-207
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-23
Family C1 set domains (antibody constant domain-like) 0.0000066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393431   Gene: ENSG00000223793   Transcript: ENST00000447735
Sequence length 255
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_DBB:32688301:32694153:1 gene:ENSG00000223793 transcript:ENST00000447735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL
Download sequence
Identical sequences P01906 Q76NI6
ENSP00000364076 ENSP00000393431 ENSP00000401098 ENSP00000405833 ENSP00000447668 ENSP00000448003 9606.ENSP00000364076 9606.ENSP00000391434 9606.ENSP00000405833 9606.ENSP00000410573 NP_064440.1.87134 NP_064440.1.92137 gi|11095447|ref|NP_064440.1| ENSP00000364076 ENSP00000393431 ENSP00000401098 ENSP00000405833 ENSP00000447668 ENSP00000448003 ENSP00000364076 ENSP00000393431 ENSP00000401098 ENSP00000405833 NYSGRC-IgSF-2DA2_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]