SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000394303 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394303
Domain Number 1 Region: 855-933
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 161-252
Classification Level Classification E-value
Superfamily Immunoglobulin 5.96e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 251-301
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000575
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 307-354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 54-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000281
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394303   Gene: ENSG00000156687   Transcript: ENST00000453357
Sequence length 958
Comment pep:known chromosome:GRCh37:8:35401910:35652180:1 gene:ENSG00000156687 transcript:ENST00000453357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAAATAGGGGGARRWLPWLGLCFWAAGTAAARGTDNGEALPESIPSAPGTLPHFIEEP
DDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTR
QQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHC
RPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKR
RSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT
CTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCI
LDKKPLHEIKPQRWSRRGIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVI
DSSALTGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLF
NPLSDIKVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKMPYIQNLSS
LPTRTELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGS
EVLLSPEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDEST
SCYCLLDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDN
TPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPF
SRVWCSNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFF
AQEDSTFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQS
SPSAVILNLWEARHQHDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL
Download sequence
Identical sequences C9J2B6 H2R9V2
ENSP00000412652 XP_009453448.1.37143 ENSP00000412652 ENSP00000394303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]