SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396557 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396557
Domain Number 1 Region: 279-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-43
Family SPRY domain 0.0002
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 1.56e-16
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 3 Region: 85-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000504
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSP00000396557
Domain Number - Region: 178-244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00555
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396557   Gene: ENSG00000204449   Transcript: ENST00000432771
Sequence length 452
Comment pep:known chromosome:GRCh37:11:89764274:89806558:1 gene:ENSG00000204449 transcript:ENST00000432771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVFQGELICPLCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVQCSECTKSTE
QINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKIFCEVDRSLLCLLCSSSQE
HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIR
AEYQKMPAFHHEEEKHNLEMLKKKGKEIFHRLHLSKAKMAHRMEILRGMYEELNEMCHKP
DVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANSDI
FLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGKYYWEVHVGDSWNWAFGVCNM
YRKEKNQNEKIDGKEGLFLLGCIKNDIQCSLFTTSPLMLQYIPKPTSRVGLFLDCEAKTV
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF
Download sequence
Identical sequences P0CI26
gi|305377072|ref|NP_001182163.1| ENSP00000388299 NP_001182163.1.87134 NP_001182163.1.92137 ENSP00000388299 ENSP00000396557 9606.ENSP00000388299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]