SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397075 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397075
Domain Number 1 Region: 545-757
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.71e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000826
Further Details:      
 
Domain Number 2 Region: 92-364
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.04e-32
Family FCH domain 0.042
Further Details:      
 
Domain Number 3 Region: 493-540
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000101
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397075   Gene: ENSG00000089639   Transcript: ENST00000445806
Sequence length 970
Comment pep:known chromosome:GRCh37:19:19740640:19754414:-1 gene:ENSG00000089639 transcript:ENST00000445806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATV
TNEASCWSGPSPEGPVPLTGEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRAS
YELEFAKSTMKIAEAGKVSIQQQSHMPLQYIYTLFLEHDLSLGTLAMETVAQQKRDYYQP
LAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQRSEDLRARSQGSPEDSAP
QASPGPSKQQERRRRSREEAQAKAQEAEALYQACVREANARQQDLEIAKQRIVSHVRKLV
FQGDEVLRRVTLSLFGLRGAQAERGPRAFAALAECCAPFEPGQRYQEFVRALRPEAPPPP
PPAFSFQEFLPSLNSSPLDIRKKLSGPLPPRLDENSAEPGPWEDPGTGWRWQGTPGPTPG
SDVDSVGGGSESRSLDSPTSSPGAGTRQLVKASSTGTESSDDFEERDPDLGDGLENGLGS
PFGKWTLSSAAQTHQLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHR
RLPARTPLFGVDFLQLPRDFPEEVPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQ
AFENGRALVELSGNSPHDVSSVLKRFLQELTEPVIPFHLYDAFISLAKTLHADPGDDPGT
PSPSPEVIRSLKTLLVQLPDSNYNTLRHLVAHLFRVAARFMENKMSANNLGIVFGPTLLR
PPDGPRAASAIPVTCLLDSGHQAQLVEFLIVHYEQIFGMDELPQATEPPPQDSSPAPGPL
TTSSQPPPPHLDPDSQPPVLASDPGPDPQHHSTLEQHPTATPTEIPTPQSDQREDVAEDT
KDGGGEVSSQGPEDSLLGTQSRGHFSRQPVKYPRGGVRPVTHQLSSLALVASKLCEETPI
TSVPRGSLRGRGPSPAAASPEGSPLRRTPLPKHFEITQETARLLSKLDSEAVPRATCCPD
VQPEEAEDHL
Download sequence
Identical sequences A0A024R7N1 Q9P107
9606.ENSP00000203556 ENSP00000203556 HR3609 gi|91208437|ref|NP_057657.2| ENSP00000397075 ENSP00000203556 NP_057657.2.87134 NP_057657.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]