SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398776 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398776
Domain Number 1 Region: 40-515
Classification Level Classification E-value
Superfamily Sema domain 7.19e-158
Family Sema domain 0.000000000000011
Further Details:      
 
Domain Number 2 Region: 1097-1359
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-79
Family Protein kinases, catalytic subunit 0.000000000134
Further Details:      
 
Domain Number 3 Region: 654-728
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000312
Family E-set domains of sugar-utilizing enzymes 0.034
Further Details:      
 
Domain Number 4 Region: 561-657
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000458
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 5 Region: 517-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000139
Family Plexin repeat 0.0000401
Further Details:      
 
Domain Number 6 Region: 774-843
Classification Level Classification E-value
Superfamily E set domains 0.00000268
Family Other IPT/TIG domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398776   Gene: ENSG00000105976   Transcript: ENST00000422097
Sequence length 1408
Comment pep:putative chromosome:GRCh37:7:116398571:116409963:1 gene:ENSG00000105976 transcript:ENST00000422097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISTWWKEPLNIVSFLFCFASGGSTITG
VGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFM
LDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSC
ENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSIS
TALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVD
YRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPEL
VQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVS
QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLI
GFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTG
AKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRL
LQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCV
APYPSLLSSEDNADDEVDTRPASFWETS
Download sequence
Identical sequences A0A024R728
ENSP00000317272 ENSP00000317272 9606.ENSP00000317272 gi|188595716|ref|NP_001120972.1| ENSP00000398776 NP_001120972.1.87134 NP_001120972.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]