SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400883 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400883
Domain Number 1 Region: 155-429
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-86
Family Calponin-homology domain, CH-domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 1702-1918
Classification Level Classification E-value
Superfamily Plakin repeat 6.8e-45
Family Plakin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 1923-2107
Classification Level Classification E-value
Superfamily Plakin repeat 1.29e-39
Family Plakin repeat 0.0007
Further Details:      
 
Domain Number 4 Region: 6722-6881
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-28
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 6548-6665
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 445-561
Classification Level Classification E-value
Superfamily Spectrin repeat 1.25e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 6963-7098
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 6063-6222
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-24
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 6304-6444
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 5520-5677
Classification Level Classification E-value
Superfamily Spectrin repeat 6.16e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 11 Region: 4751-4900
Classification Level Classification E-value
Superfamily Spectrin repeat 1.36e-21
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 12 Region: 7094-7209
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 13 Region: 4283-4441
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-20
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 14 Region: 5084-5238
Classification Level Classification E-value
Superfamily Spectrin repeat 1.54e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 15 Region: 7456-7535
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.2e-19
Family GAS2 domain 0.00053
Further Details:      
 
Domain Number 16 Region: 6884-6993
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-19
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 17 Region: 5956-6113
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-19
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 18 Region: 7159-7286,7316-7347
Classification Level Classification E-value
Superfamily Spectrin repeat 9e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 19 Region: 6438-6555
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-18
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 20 Region: 5297-5457
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 21 Region: 1414-1542,1569-1597
Classification Level Classification E-value
Superfamily Spectrin repeat 4.88e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 22 Region: 879-981
Classification Level Classification E-value
Superfamily Spectrin repeat 6.77e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 23 Region: 7367-7447
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000133
Family Polcalcin 0.044
Further Details:      
 
Domain Number 24 Region: 5674-5789
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000209
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 25 Region: 4972-5094
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000389
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 26 Region: 5855-6003
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000019
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 27 Region: 6220-6333
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000262
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 28 Region: 4056-4174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000344
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 29 Region: 4191-4297
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000108
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 30 Region: 4883-4985
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000619
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 31 Region: 4500-4620
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000166
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 4659-4768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000312
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 33 Region: 786-878
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000055
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 34 Region: 960-1061,1182-1202
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000187
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000400883
Domain Number - Region: 3568-3677
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000417
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 3820-3933
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00314
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 1199-1349
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00563
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400883   Gene: ENSG00000151914   Transcript: ENST00000421834
Sequence length 7750
Comment pep:known chromosome:GRCh37:6:56322787:56707943:-1 gene:ENSG00000151914 transcript:ENST00000421834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAAAFLVLLRPYSIQCALFLLLLLLGTIATIVFFCCWHRKLQKGRHPMKSVFSGRSRSR
DAVLRSHHFRSEGFRASPRHLRRRVAAAAAARLEEVKPVVEVHHQSEQETSVRKRRIKKS
SRVQPEFYHSVQGASIRRPSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGDTLPWN
LPKHERSKRKIQGGSVLDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYED
LRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGN
PKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRD
GKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKS
VITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFPNN
PVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEKEW
GKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGV
QFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSS
VYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSG
MTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEE
INMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISE
IQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEE
VAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAA
MQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHK
LEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIE
ITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNV
LTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLED
SQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLENC
EDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSS
VPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVI
ADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKE
KADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPE
NSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKS
PVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEH
VEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKH
GDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKLDKVIAGTIDQT
TGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQILC
QLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLTL
QKAFQQNLVSSALFSKVLERQNMCKDLIDPCTSEKVSLIDMVQRSTLQENTGMWLLPVRP
QEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAVRE
GVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLI
WPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALYIPESSQVIGLDAAKQLGIIDNN
TASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTTQT
SEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDV
LSSSGVFLNNASGREKDECTATPSSFNKCHCGEPEHEETPENRKCAIDEEFNEMRNTVIN
SEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYENQS
RVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDYSP
RLSALLSHDKLMHSQGSFNDTHTPESNGNKCEAPALSFSDKTMLSGQRIGEKFQDQFLGI
AAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDESE
IEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDDFY
DTPLFEDDDHDSLLLDGDDRDCLHPEDYDTLQEENDETASPADVFYDVSKENENSMVPQG
APVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTNIL
EGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEES
YGDYIYDSNDQDDDDDDGIDEEGGGIRDENGKPRCQNVAEDMDIQLCASILNENSDENEN
INTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLLNH
EMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPELT
DSVKGKDEYFKNMTPKVDSSLDHIICTEPDLIGKPAEESHLSLIASVTDKDPQGNGSDLI
KGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQFP
FPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDI
TSDITSWEGNTHFEESFTDGPEKELDLFTYLKHCAKNIKAKDVAKPNEDVPSHVLITAPP
MKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEATLS
ILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQAL
SPRSQEKEVQIPELSQVFVEDVKDILKSRLKEGHMNPQEVEEPSACADTKILIQNLIKRI
TTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQDQ
HSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDFNQ
KACSTSEMMEEKPHILGDIKSKEGNYYSPNLETVKEIGLESSTVWASTLPRDEKLKDLCN
DFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQESLD
NNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSL
KTAFSSLSNVSSERTKQIMLAIDSEMSKLAVSHEEFLHKLKSFSDWVSEKSKSVKDIEIV
NVQDSEYVKKRLEFLKANNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRL
LNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTE
NRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSQ
EDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIE
NLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVG
TTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKEL
KVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLM
TKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDH
ATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPK
NLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYED
LSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKN
IMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAK
MEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHL
EVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVL
VKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCN
LISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLL
LKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKS
FEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKL
EESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKP
QYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQ
YQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALC
EDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQA
WLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGS
EKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEE
IKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLI
QKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKY
LTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQVD
EKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKK
LEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTI
KRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQ
DVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDA
LESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIA
TTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTI
EKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMV
QSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQD
YSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARY
KDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQM
RPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKV
EEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILR
HKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVN
QFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKT
GPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILES
LERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTD
KDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDF
IRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKS
IDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDL
ETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDS
LEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKH
HVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQ
LDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKE
ETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEF
HNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGT
HLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWL
EESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADD
NLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAED
QPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELS
TRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDALRT
LIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAK
QHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFM
EEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIET
KNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKS
RVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVA
ALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRVSFQSNFGDSQQLR
LVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRT
NMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTT
PKGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKA
GSRASSRRGSDASDFDISEIQSVCSDVETVPQTHRPTPRAGSRPSTAKPSKIPTPQRKSP
ASKLDKSSKR
Download sequence
Identical sequences ENSP00000359790 ENSP00000400883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]